Primary information |
---|
ID | 15841 |
Uniprot ID | Q5H8A3 |
Description | NmU family |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | secreted |
Developmental Stage | Expressed throughout the enteric nervous system with highest levels being found in the jejunum. |
Similarity | NmU family |
Tissue Specificity | Expressed throughout the enteric nervous system with highest levels being found in the jejunum. |
Post Translational Modification | T33 Asparagine amide |
Function | Implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.;act as potent vasoconstrictors |
Length | 33 |
Molecular Weight | 0 |
Name | Neuromedin-S |
Sequence | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN |
Sequence map | NA |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|