| Primary information |
|---|
| ID | 15841 |
| Uniprot ID | Q5H8A3 |
| Description | NmU family |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | secreted |
| Developmental Stage | Expressed throughout the enteric nervous system with highest levels being found in the jejunum. |
| Similarity | NmU family |
| Tissue Specificity | Expressed throughout the enteric nervous system with highest levels being found in the jejunum. |
| Post Translational Modification | T33 Asparagine amide |
| Function | Implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.;act as potent vasoconstrictors |
| Length | 33 |
| Molecular Weight | 0 |
| Name | Neuromedin-S |
| Sequence | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|