| Primary information |
|---|
| ID | 15699 |
| Uniprot ID | P12285 |
| Description | FMRFamide-like neuropeptide YLRF-amide |
| Organism | Aplysia californica |
| Txonomy | Hirudo ; Hirudinidae ; Hirudiniformes ; Hirudinida ; Hirudinea (subclass); Clitellata ; Annelida ; Lophotrochozoa ; Spiralia ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | acts as an osmoregulatory peptide; increasing blood volume; and also modulates the activity of a set of cardiac motor neurons that control heart rate |
| Length | 4 |
| Molecular Weight | 598 |
| Name | R15 alpha-1 peptide |
| Sequence | DVSDGSAERRPYTRMGSGGLKLHCQVHPANCPGGLMVT |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|