Primary information |
---|
ID | 15301 |
Uniprot ID | P17685;P17686 |
Description | Antho-RIamide-1 (Antho-RIamide I) [Cleaved into- Antho-RIamide-2 (Antho-RIamide II)] |
Organism | Aplysia parvula |
Txonomy | Anthopleura ; Actiniidae ; Actiniaria ; Hexacorallia (subclass); Anthozoa ; Cnidaria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
Subcellular Location | secreted |
Developmental Stage | NA |
Similarity | Molluscan ELH family |
Tissue Specificity | Neuron specific. |
Post Translational Modification | T36 Lysine amide |
Function | ELH acts as a neurotransmitter locally; upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string. |
Length | 4 |
Molecular Weight | 598 |
Name | Egg-laying hormone |
Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
Sequence map | NA |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|