| Primary information |
|---|
| ID | 15301 |
| Uniprot ID | P17685;P17686 |
| Description | Antho-RIamide-1 (Antho-RIamide I) [Cleaved into- Antho-RIamide-2 (Antho-RIamide II)] |
| Organism | Aplysia parvula |
| Txonomy | Anthopleura ; Actiniidae ; Actiniaria ; Hexacorallia (subclass); Anthozoa ; Cnidaria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Molluscan ELH family |
| Tissue Specificity | Neuron specific. |
| Post Translational Modification | T36 Lysine amide |
| Function | ELH acts as a neurotransmitter locally; upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string. |
| Length | 4 |
| Molecular Weight | 598 |
| Name | Egg-laying hormone |
| Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|