Primary information |
---|
ID | 14404 |
Uniprot ID | NA |
Description | Gastrin/cholecystokinin family |
Organism | Canis familiaris |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Cnidaria; Anthozoa; Hexacorallia; Actiniaria; Actiniidae; Anthopleura |
Subcellular Location | secreted |
Developmental Stage | NA |
Similarity | Gastrin/cholecystokinin family |
Tissue Specificity | NA |
Post Translational Modification | T27 Sulfotyrosine;T33 Phenylalanine amide |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion. |
Length | 33 |
Molecular Weight | 0 |
Name | Cholecystokinin-33 |
Sequence | KAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF |
Sequence map | NA |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|