| Primary information |
|---|
| ID | 14401 |
| Uniprot ID | NA |
| Description | Gastrin/cholecystokinin family |
| Organism | Canis familiaris |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Cnidaria; Anthozoa; Hexacorallia; Actiniaria; Actiniidae; Anthopleura |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Gastrin/cholecystokinin family |
| Tissue Specificity | NA |
| Post Translational Modification | T52 Sulfotyrosine;T58 Phenylalanine amide |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion.stimulate amylase release from the pancreas.increases bile-pancreatic volume |
| Length | 58 |
| Molecular Weight | 0 |
| Name | Cholecystokinin-58 |
| Sequence | AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|