| Primary information |
|---|
| ID | 14304 |
| Uniprot ID | P10362 |
| Description | CalliFMRFamide-11 |
| Organism | Rattus norvegicus |
| Txonomy | Calliphora ; Calliphorinae ; Calliphoridae ; Oestroidea ; Calyptratae ; Schizophora ; Cyclorrhapha ; Eremoneura ; Muscomorpha ; Brachycera ; Diptera ; Endopterygota (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Chromogranin/secretogranin protein family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulates the biogenesis of secretory granules |
| Length | 7 |
| Molecular Weight | 926 |
| Name | Secretoneurin |
| Sequence | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|