| Primary information |
|---|
| ID | 14298 |
| Uniprot ID | P13521 |
| Description | Myotropic neuropeptide 1 (Led-MNP-I) |
| Organism | Homo sapiens |
| Txonomy | Leptinotarsa ; Doryphorini (tribe); Chrysomelinae ; Chrysomelidae ; Chrysomeloidea ; Cucujiformia ; Polyphaga ; Coleoptera ; Endopterygota (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Chromogranin/secretogranin protein family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | regulates the biogenesis of secretory granules. |
| Length | 7 |
| Molecular Weight | 705 |
| Name | Secretoneurin |
| Sequence | TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|