| Primary information |
|---|
| ID | 14297 |
| Uniprot ID | P20616 |
| Description | Periviscerokinin-2 (Pea-PVK-2) (Periviscerokinin-3) (PerAm-PVK-3) |
| Organism | Bos taurus |
| Txonomy | Periplaneta ; Blattinae ; Blattidae ; Blattoidea ; Blattodea ; Dictyoptera ; Polyneoptera (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Chromogranin/secretogranin protein family |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulate the biogenesis of secretory granules |
| Length | 12 |
| Molecular Weight | 1 |
| Name | Secretoneurin |
| Sequence | TNEIVEEQYTPQNLATLESVFQELGKLTGPNSQ |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|