| Primary information |
|---|
| ID | 14288 |
| Uniprot ID | P30945 |
| Description | Pyrokinin-1 (Pea-PK-1) (FXPRL-amide) |
| Organism | Pelophylax ridibundus |
| Txonomy | Periplaneta ; Blattinae ; Blattidae ; Blattoidea ; Blattodea ; Dictyoptera ; Polyneoptera (cohort); Neoptera (infraclass); Pterygota (subclass); Dicondylia ; Insecta ; Hexapoda ; Pancrustacea ; Mandibulata ; Arthropoda ; Panarthropoda ; Ecdysozoa ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | Chromogranin/secretogranin protein family |
| Tissue Specificity | Corpora cardiaca. |
| Post Translational Modification | NA |
| Function | May be important in regulation of neurosecretion. |
| Length | 9 |
| Molecular Weight | 1 |
| Name | Secretoneurin |
| Sequence | TNEIVEGQYTPQSLATLQSVFQELGKLKGQANN |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|