| Primary information |
|---|
| ID | 14202 |
| Uniprot ID | P85797 |
| Description | Peptide POLARIS (Protein expressed in embryo 101) (AtEM101) |
| Organism | Apis mellifera |
| Txonomy | Arabidopsis ; Camelineae (tribe); Brassicaceae ; Brassicales ; malvids ; rosids ; Pentapetalae ; Gunneridae ; eudicotyledons ; Mesangiospermae ; Magnoliopsida ; Spermatophyta ; Euphyllophyta ; Tracheophyta ; Embryophyta ; Streptophytina ; Streptophyta ; Viridiplantae ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | First observed in embryos from the heart stage and throughout embryo development; restricted to the basal part; constituting the developing radicle. During the curled cotyledonary stage; strongly expr |
| Similarity | Allatostatin family |
| Tissue Specificity | Mostly expressed in the embryonic root from the heart stage and in the seedling primary and lateral root tips; especially in the columella initials and lateral root cap. Also detectable in aerial part |
| Post Translational Modification | NA |
| Function | NA |
| Length | 36 |
| Molecular Weight | 4 |
| Name | Allatostatin-5 |
| Sequence | NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|