| Primary information |
|---|
| ID | 13798 |
| Uniprot ID | O44665 |
| Description | Conorfamide-Tx2 (CNF-Tx2) (Cono-RFamide-Tx2) |
| Organism | Caenorhabditis elegans |
| Txonomy | Cylinder (subgenus); Conus ; Conidae ; Conoidea ; Neogastropoda ; Caenogastropoda (subclass); Gastropoda ; Mollusca ; Lophotrochozoa ; Spiralia ; Protostomia ; Bilateria ; Eumetazoa ; Metazoa ; Opisthokonta ; Eukaryota ; cellular organisms |
| Subcellular Location | secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed by the venom duct. |
| Post Translational Modification | T7 Tyrosine amide;T17 Tyrosine amide;T24 Tyrosine amide;T31 Tyrosine amide;T36 Tryptophan amide;T45 Tryptophan amide |
| Function | May have antimicrobial activity. May play a role in response to fungal infection. |
| Length | 72 |
| Molecular Weight | 8 |
| Name | Neuropeptide-like protein 30 |
| Sequence | QWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK |
| Sequence map | NA |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|