| Primary information |
|---|
| ID | 13758 |
| Uniprot ID | P93193 |
| Description | Ipomoelin (Jacalin related lectin) (JRL) |
| Organism | Ipomoea batatas |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea; Ipomoea batatas (Sweet potato) (Convolvulus batatas) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the jacalin lectin family. |
| Tissue Specificity | Expressed in leaves (at protein level) (PubMed-9249986; Ref.4). Expressed in leaves and to a lesser extent in petioles. Not expressed in stems or tuberous roots (PubMed-9249986). |
| Post Translational Modification | The N-terminus is blocked. |
| Function | Lectin involved in defense reactions of the leaves in response to wounding by herbivorous insects and pathogens (Probable). Retards the growth and development of silkworm thus reducing their survival rates. Has hemagglutinating activity against human erythrocytes (Ref.4). |
| Length | 154 |
| Molecular Weight | 16 |
| Name | Ipomoelin |
| Sequence | ALQLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTDIITVGGVGPEPLTYTETVNIDGDIIEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAYYTAK |
| Sequence map | 3-34 |
| PDB ID | 3R50; 3R51; 3R52; 4DDN; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|