| Primary information |
|---|
| ID | 13754 |
| Uniprot ID | Q08738 |
| Description | Larval cuticle protein LCP-30 |
| Organism | Bombyx mori |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Bombycoidea (hawk-moths); Bombycidae (silkworm moths); Bombycinae; Bombyx; Bombyx mori (Silk moth) |
| Subcellular Location | NA |
| Developmental Stage | Exists in integuments throughout the larval stages and disappears at larval-pupal ecdysis. Present in lower amount adult cuticle after eclosion. |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Major cuticle protein of the integuments. May interact with both chitin and epidermal cells to form stable cuticular structures. |
| Length | 239 |
| Molecular Weight | 25 |
| Name | Larval cuticle protein LCP-30 |
| Sequence | ETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAYNGDRGDRGAAGGFYTGSGTAGGPGGAYVGTKEDLSKYLGDAYKGSSIVPLPVVKPTIPVPVTPTYVASKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENIGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGFVADGAHIPK |
| Sequence map | 20-59 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|