| Primary information |
|---|
| ID | 13751 |
| Uniprot ID | Q9W2N0 |
| Description | F-actin-capping protein subunit alpha |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the F-actin-capping protein alpha subunit family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin); these proteins do not sever actin filaments. |
| Length | 286 |
| Molecular Weight | 32 |
| Name | F-actin-capping protein subunit alpha |
| Sequence | EQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ |
| Sequence map | 5-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|