| Primary information |
|---|
| ID | 13735 |
| Uniprot ID | P02659 |
| Description | Apovitellenin-1 (Apo-VLDL-II) (Apo-II) (Apovitellenin I) (Very low density lipoprotein II) |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | NA |
| Developmental Stage | ApoII mRNA induction by estrogen in kidney at day 11 is at 10% of the level in the liver but estrogen-responsiveness decreases later in development and is low in the adult. |
| Similarity | Belongs to the apovitellenin family. |
| Tissue Specificity | Produced by the liver; secreted into the blood and then sequestred by receptor mediated endocytosis into growing oocytes. |
| Post Translational Modification | NA |
| Function | Protein component of the very low density lipoprotein (VLDL) of egg-laying females. Potent lipoprotein lipase inhibitor; preventing the loss of triglycerides from VLDL on their way from the liver to the growing oocytes. |
| Length | 106 |
| Molecular Weight | 11 |
| Name | Apovitellenin-1 |
| Sequence | SIIDRERRDWLVIPDAAAAYIYEAVNKVSPRAGQFLLDVSQTTVVSGIRNFLINETARLTKLAEQLMEKIKNLCYTKVLGY |
| Sequence map | 26-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|