| Primary information |
|---|
| ID | 13734 |
| Uniprot ID | Q9YHV4 |
| Description | Follistatin-A (FS) (Activin-binding protein) (Follistatin-1) (zFst1) |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | NA |
| Developmental Stage | First expressed at mid-gastrulation. |
| Similarity | NA |
| Tissue Specificity | Not expressed in the organizer region. Expression in gastrulating embryos is confined to anterior and paraxial regions; which give rise to head mesoderm and the first five somites. In addition; expres |
| Post Translational Modification | NA |
| Function | Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (fsh). Inhibits bmp-signaling during later stages of development including late phases of dorsoventral patterning; to refine the early pattern set up by the interaction of chordino and bmp2/4. Not involved in organizer function or early phases of dorsoventral pattern formation. |
| Length | 322 |
| Molecular Weight | 35 |
| Name | Follistatin-A |
| Sequence | NCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTSWTEEDVPNSTLFRWMIFNGGAPNCIPCKETCDNVDCGPGKRCKMNRRSKPRCVCAPDCSNVTWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKTCRDVLCPGSSTCVVDQTNNAYCVTCNRICPEVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSCDDIHCSAGKKCLWDAKMSRGRCAVCAESCPESRSEEAVCASDNTTYPSECAMKQAACSLGVLLEVKHSGSCNCK |
| Sequence map | 38-22 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|