Primary information |
---|
ID | 13732 |
Uniprot ID | P62324 |
Description | Protein BTG1 (B-cell translocation gene 1 protein) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | NA |
Developmental Stage | Its expression is associated with the early G1 phase of the cell cycle. |
Similarity | Belongs to the BTG family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Anti-proliferative protein. |
Length | 171 |
Molecular Weight | 19 |
Name | Protein BTG1 |
Sequence | HPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
Sequence map | 3-51 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|