| Primary information |
|---|
| ID | 13731 |
| Uniprot ID | P62931 |
| Description | Albumin-1 F (PA1 F) (PsaA1b005/PsaA1b011) [Cleaved into- Albumin-1 F chain b (Leginsulin F) (PA1b F); Albumin-1 F chain a (PA1a F)] |
| Organism | Pisum sativum |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Fabeae; Pisum; Pisum sativum (Garden pea) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | The C-terminal glycine may be removed from PA1b. |
| Function | PA1b binds to basic 7S globulin (BG) and stimulates its phosphorylation activity. Involved in the signal transduction system to regulate the growth and differentiation as a hormone peptide. Toxic to various insects through binding to a high affinity binding site in the insect gut. |
| Length | 130 |
| Molecular Weight | 13 |
| Name | Albumin-1 F chain b |
| Sequence | SCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG |
| Sequence map | 28-03 |
| PDB ID | 1P8B; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The presence of a 'disulfide through disulfide kno |
| Pharmaceutical Use | NA
|