| Primary information |
|---|
| ID | 13729 |
| Uniprot ID | Q63073 |
| Description | Protein BTG1 (Anti-proliferative factor) (B-cell translocation gene 1 protein) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the BTG family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Anti-proliferative protein. |
| Length | 171 |
| Molecular Weight | 19 |
| Name | Protein BTG1 |
| Sequence | HPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSSQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
| Sequence map | 3-51 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|