| Primary information |
|---|
| ID | 13724 |
| Uniprot ID | Q25504 |
| Description | Larval cuticle protein 16/17 |
| Organism | Manduca sexta |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Bombycoidea (hawk-moths); Sphingidae (hawkmoths); Sphinginae (small-eyed sphinx moth); Sphingini; Manduca; Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Subcellular Location | NA |
| Developmental Stage | Expressed late on the penultimate day of feeding in the fifth larval instar. Highest levels throughout the final day of feeding. Barely detectable by the day of wandering. Expression stops when the me |
| Similarity | NA |
| Tissue Specificity | Specific to the epidermis. Expressed in all the epidermal cells of day 3 larvae except for the bristle cells and those at the muscle attachment sites. |
| Post Translational Modification | NA |
| Function | Component of the cuticle of the larva of tobacco hornworm. Seems to participate in the formation of 5- to 10-fold thinner lamellae in the endocuticle. |
| Length | 110 |
| Molecular Weight | 12 |
| Name | Larval cuticle protein 16/17 |
| Sequence | EPEPPKILRSEYDQKPEGSYVFGFETEDGISRDETGEVKEALDEDNKPHSVVVVRGQYSYVDPDGNPQVIKYYADETGYHAEGDSIPKVPSRR |
| Sequence map | 18-50 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|