Primary information |
---|
ID | 13723 |
Uniprot ID | Q9LMM6 |
Description | Protein BPS1; chloroplastic (Protein BYPASS 1) |
Organism | Arabidopsis thaliana |
Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana (Mouse-ear cress) |
Subcellular Location | Plastid; chloroplast |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Expressed in roots; hypocotyls; cotyledons; leaves; flowers and siliques. |
Post Translational Modification | NA |
Function | Required for normal root and shoot development. Prevents constitutive production of a root mobile carotenoid-derived signaling compound that is capable of arresting shoot and leaf development. |
Length | 349 |
Molecular Weight | 38 |
Name | Protein BPS1; chloroplastic |
Sequence | SSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPRIENCRAILSSLVQTLNLPKVKNSAKGKVLMRALYGVKVKTLYISGVFAAAFSGSSQNLMYLTVSNELPWAQSFMEVQNTMNAEIKNIFLSDGLTVLKELEAVASGVKKLYPAIQQGSIDPISLQPLKDSVTELSNGIDLVSKEVDCFFKILLSGRDTLLENLRSMGASTLQATSPKKAAGKNYRGF |
Sequence map | 49-49 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|