| Primary information |
|---|
| ID | 13721 |
| Uniprot ID | P04342 |
| Description | Gamma-crystallin D (Gamma-D-crystallin) (Gamma-crystallin 1) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the beta/gamma-crystallin family. |
| Tissue Specificity | Detected in the superior olivary complex of the auditory hindbrain. |
| Post Translational Modification | NA |
| Function | Crystallins are the dominant structural components of the vertebrate eye lens. |
| Length | 174 |
| Molecular Weight | 21 |
| Name | Gamma-crystallin D |
| Sequence | GKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIEFTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRVMDFY |
| Sequence map | 3-54 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Has a two-domain beta-structure; folded into four |
| Pharmaceutical Use | NA
|