Primary information |
---|
ID | 13721 |
Uniprot ID | P04342 |
Description | Gamma-crystallin D (Gamma-D-crystallin) (Gamma-crystallin 1) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the beta/gamma-crystallin family. |
Tissue Specificity | Detected in the superior olivary complex of the auditory hindbrain. |
Post Translational Modification | NA |
Function | Crystallins are the dominant structural components of the vertebrate eye lens. |
Length | 174 |
Molecular Weight | 21 |
Name | Gamma-crystallin D |
Sequence | GKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIEFTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRVMDFY |
Sequence map | 3-54 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | Has a two-domain beta-structure; folded into four |
Pharmaceutical Use | NA
|