| Primary information |
|---|
| ID | 13716 |
| Uniprot ID | Q56YT7 |
| Description | Vascular-related unknown protein 3 |
| Organism | Arabidopsis thaliana |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis; Arabidopsis thaliana (Mouse-ear cress) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in the regulation of plant growth. |
| Length | 130 |
| Molecular Weight | 14 |
| Name | Vascular-related unknown protein 3 |
| Sequence | ENSALSNCVRRTNFSNQQRTMQEGLEESSWTMYFETEDGLGHYDDSSMMSDAASPMGCVEEDTASSPSNRTEGYSGMEDNTIEEKTMNNGKIEEKILNKNGIKIEEYCAELKKRGLCLVPLSMLSNYIG |
| Sequence map | 3-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|