| Primary information |
|---|
| ID | 13706 |
| Uniprot ID | P04247 |
| Description | Myoglobin |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the globin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. |
| Length | 154 |
| Molecular Weight | 17 |
| Name | Myoglobin |
| Sequence | LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG |
| Sequence map | 4-34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|