| Primary information |
|---|
| ID | 13705 |
| Uniprot ID | P18301 |
| Description | Stanniocalcin (STC) (Corpuscles of Stannius protein) (CS) (Hypocalcin) (Teleocalcin) |
| Organism | Anguilla australis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Elopocephalai; Elopocephala; Elopomorpha; Anguilliformes (true eels); Anguillidae (freshwater eels); Anguilla; Anguilla australis (Australian eel) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the stanniocalcin family. |
| Tissue Specificity | Corpuscles of Stannius. |
| Post Translational Modification | NA |
| Function | Its primary function is the prevention of hypercalcemia. Upon release into the circulation; it lowers calcium transport by the gills; thereby reducing its rate of influx from the environment into the extracellular compartment. STC also stimulates phosphate reabsorption by renal proximal tubules. The consequence of this action is increased levels of plasma phosphate; which combines with excess calcium and promotes its disposal into bone and scales. |
| Length | 250 |
| Molecular Weight | 27 |
| Name | Stanniocalcin |
| Sequence | SASSPSDVARCLNGALQVGCSAFACLDNSTCNTDGMHEICRSFLHGAAKFDTQGKTFVKESLKCIANGITSKVFLTIRRCSSFQKMISEVQEECYSKLDLCSVAQSNPEAMGEVAQVPSQFPNRYYSTLLQSLLTCDEDTVEQVRAGLVSRLEPEMGVLFQLLQTKACPPSAAGGTGPVGAGGSWRWPMGPPMFKIQPNLRSRDPTHLFAKKRSTSS |
| Sequence map | 37-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|