| Primary information |
|---|
| ID | 13702 |
| Uniprot ID | P42579 |
| Description | Sodium-influx-stimulating peptide |
| Organism | Lymnaea stagnalis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Heterobranchia; Euthyneura; Panpulmonata; Hygrophila; Lymnaeoidea; Lymnaeidae (pond snails); Lymnaea; Lymnaea stagnalis (Great pond snail) (Helix stagnalis) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed by the yellow cells; peptidergic (neuroendocrine) neurons of the central nervous system. |
| Post Translational Modification | Three disulfide bonds are present. |
| Function | Stimulates integumental Na(+) uptake. Controls the activity of sodium pumps in the integument; pericardium; ureter and nephridial gland. |
| Length | 100 |
| Molecular Weight | 11 |
| Name | Sodium-influx-stimulating peptide |
| Sequence | SRTQSRFASYELMGTEGTECVTTKTISQICYQCATRHEDSFVQVYQECCKKEMGLREYCEEIYTELPIRSGLWQPNK |
| Sequence map | 1848 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|