Primary information |
---|
ID | 13701 |
Uniprot ID | P80045 |
Description | Ovary maturating parsin (OMP) |
Organism | Locusta migratoria |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Oedipodinae (band-winged grasshoppers); Locusta; Locusta migratoria (Migratory locust) |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Neurohormone that anticipates ovarian maturation. Acts as a true gonadotropin and stimulates vitellogenin biosynthesis. |
Length | 65 |
Molecular Weight | 6 |
Name | Ovary maturating parsin |
Sequence | YYEAPPDGRHLLLQPAPAAPAVAPAAPASWPHQQRRQALDEFAAAAAAAADAQFQDEEEDGGRRV |
Sequence map | 1560 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|