| Primary information |
|---|
| ID | 13701 |
| Uniprot ID | P80045 |
| Description | Ovary maturating parsin (OMP) |
| Organism | Locusta migratoria |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Oedipodinae (band-winged grasshoppers); Locusta; Locusta migratoria (Migratory locust) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurohormone that anticipates ovarian maturation. Acts as a true gonadotropin and stimulates vitellogenin biosynthesis. |
| Length | 65 |
| Molecular Weight | 6 |
| Name | Ovary maturating parsin |
| Sequence | YYEAPPDGRHLLLQPAPAAPAVAPAAPASWPHQQRRQALDEFAAAAAAAADAQFQDEEEDGGRRV |
| Sequence map | 1560 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|