| Primary information |
|---|
| ID | 13699 |
| Uniprot ID | P10776 |
| Description | Neuroparsin-A (NPA) [Cleaved into- Neuroparsin-B (NPB)] |
| Organism | Locusta migratoria |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Oedipodinae (band-winged grasshoppers); Locusta; Locusta migratoria (Migratory locust) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurosparins are multifunctional neurohormones- they inhibit the effects of juvenile hormone; stimulate fluid reabsorption of isolated recta and induces an increase in hemolymph lipid and trehalose levels. |
| Length | 107 |
| Molecular Weight | 11 |
| Name | Neuroparsin-A |
| Sequence | SCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC |
| Sequence map | 1872 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|