| Primary information |
|---|
| ID | 13681 |
| Uniprot ID | P80594 |
| Description | Egg-laying-like hormone (L-ELH) |
| Organism | Theromyzon tessulatum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Annelida; Clitellata; Hirudinea (leeches); Rhynchobdellida; Glossiphoniidae; Theromyzon; Theromyzon tessulatum (Duck leech) |
| Subcellular Location | NA |
| Developmental Stage | L-ELH greatly increases before egg-laying; while it strongly decreases after egg-laying. |
| Similarity | NA |
| Tissue Specificity | Supra; subesophageal ganglia and segmental ganglia of the ventral nerve cord and brain. |
| Post Translational Modification | NA |
| Function | May be involved in leech reproduction. |
| Length | 36 |
| Molecular Weight | 4 |
| Name | Egg-laying-like hormone |
| Sequence | GSGVSNGGTEMIQLSHIRERQRYWAQDNLRRRFLEK |
| Sequence map | 864 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|