| Primary information |
|---|
| ID | 13677 |
| Uniprot ID | P32005 |
| Description | Oxytocin-neurophysin 1 (OT-NPI) [Cleaved into- Oxytocin (Ocytocin); Neurophysin 1] (Fragment) |
| Organism | Papio hamadryas |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Papio (baboons); Papio hamadryas (Hamadryas baboon) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). |
| Length | 85 |
| Molecular Weight | 8 |
| Name | Oxytocin-neurophysin 1 |
| Sequence | AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVFGLCCSPDGC |
| Sequence map | 1896 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|