| Primary information |
|---|
| ID | 13665 |
| Uniprot ID | P01249 |
| Description | Thymopoietin-1 (Thymopoietin I) |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the thymopoietin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone of the thymus with pleiotropic actions on prothymocytes; mature T-cells; the nicotinic acetylcholine receptor; and pituitary corticotrophs. |
| Length | 49 |
| Molecular Weight | 5 |
| Name | Thymopoietin-1 |
| Sequence | GQFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVELYLQHLTALKR |
| Sequence map | 1176 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|