| Primary information |
|---|
| ID | 13658 |
| Uniprot ID | P48061 |
| Description | Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into- SDF-1-beta(3-72); SDF-1-alpha(3-67)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Isoform Alpha is ubiquitously expressed in fetal tissues. Isoform Beta and isoform Delta have more limited expression patterns; with highest levels detected in fetal spleen and fetal liver; respective |
| Similarity | Belongs to the intercrine alpha (chemokine CxC) family. |
| Tissue Specificity | Isoform Alpha and isoform Beta are ubiquitously expressed; with highest levels detected in liver; pancreas and spleen. Isoform Gamma is mainly expressed in heart; with weak expression detected in seve |
| Post Translational Modification | Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha; respectively. The N-terminal processing is probably achieved by |
| Function | Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3; which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV-ITGB3; ITGA4-ITGB1 and ITGA5-ITGB1 in a CXCR4-independent manner |
| Length | 93 |
| Molecular Weight | 10 |
| Name | Stromal cell-derived factor 1 |
| Sequence | PVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Sequence map | 23-33 |
| PDB ID | 1A15; 1QG7; 1SDF; 1VMC; 2J7Z; 2K01; 2K03; 2K04; 2K05; 2KEC; 2KED; 2KEE; 2KOL; 2N55; 2NWG; 2SDF; 3GV3 |
| Drugpedia | DB05934;DB06822; |
| Receptor | P30991; P30991 |
| Domain | NA |
| Pharmaceutical Use | NA
|