| Primary information |
|---|
| ID | 13655 |
| Uniprot ID | P17251 |
| Description | Parathyroid hormone-related protein (PTH-rP) (PTHrP) [Cleaved into- Osteostatin (PTHrP[107-139])] |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | There are several secretory forms; including osteostatin; arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its |
| Function | Neuroendocrine peptide which is a critical regulator of cellular and organ growth; development; migration; differentiation and survival and of epithelial calcium ion transport. |
| Length | 176 |
| Molecular Weight | 20 |
| Name | Parathyroid hormone-related protein |
| Sequence | VSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEIRATSEVSPNPKPATNTKNYPVRFGSEDEGRYLTQETNKSQTYKEQPLKVSGKKKKAKPGKRKEQEKKKRRARSAWLNSGMYGSNVTESPVLDNSVTTHNHILR |
| Sequence map | 40-56 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|