Primary information |
---|
ID | 13655 |
Uniprot ID | P17251 |
Description | Parathyroid hormone-related protein (PTH-rP) (PTHrP) [Cleaved into- Osteostatin (PTHrP[107-139])] |
Organism | Gallus gallus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
Subcellular Location | Cytoplasm |
Developmental Stage | NA |
Similarity | Belongs to the parathyroid hormone family. |
Tissue Specificity | NA |
Post Translational Modification | There are several secretory forms; including osteostatin; arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its |
Function | Neuroendocrine peptide which is a critical regulator of cellular and organ growth; development; migration; differentiation and survival and of epithelial calcium ion transport. |
Length | 176 |
Molecular Weight | 20 |
Name | Parathyroid hormone-related protein |
Sequence | VSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEIRATSEVSPNPKPATNTKNYPVRFGSEDEGRYLTQETNKSQTYKEQPLKVSGKKKKAKPGKRKEQEKKKRRARSAWLNSGMYGSNVTESPVLDNSVTTHNHILR |
Sequence map | 40-56 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|