| Primary information |
|---|
| ID | 13653 |
| Uniprot ID | Q8N2E6 |
| Description | Prosalusin (Torsin family 2 member A) (Torsin-2A) [Cleaved into- Salusin-alpha; Salusin-beta] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the ClpA/ClpB family. Torsin subfamily. |
| Tissue Specificity | Isoform 4 is ubiquitously expressed; with high level in vascular endothelial cells and vascular smooth muscle cells. |
| Post Translational Modification | Amidation of salusin-alpha(29-Gly) by peptidylglycine alpha-amidating monooxygenase; PAM; converts Lys-241-Gly-242 to Lys-241-NH2 and gives raise to salusin-alpha. |
| Function | Salusins -alpha and -beta may be endocrine and/or paracrine factors able to increase intracellular calcium concentrations and induce cell mitogenesis. Salusins may also be potent hypotensive peptides. |
| Length | 242 |
| Molecular Weight | 26 |
| Name | Prosalusin |
| Sequence | WDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG |
| Sequence map | 31-02 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|