| Primary information |
|---|
| ID | 13652 |
| Uniprot ID | P13432 |
| Description | SMR1 protein (VCS-alpha 1) [Cleaved into- SMR1-related undecapeptide; SMR1-related hexapeptide; Sialorphin (SMR1-related pentapeptide); Submandibular gland peptide T (SGP-T)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed predominantly in the acinar cells of the submandibular gland and to lesser extent in the prostate. |
| Post Translational Modification | Several O-linked glycosylation sites might be present in the C-terminal part. |
| Function | Sialorphin may be involved in the modulation of mineral balance between at least four systems- kidney; bone; tooth and circulation.; Submandibular gland peptide T is able to directly or indirectly down-regulate cardiovascular depression induced by septic shock (endotoxin stimuli); or anaphylactic challenge (nematode antigen sensitization).; Sialorphin is an endogenous inhibitor of neprilysin. Inhibits the breakdown of Met-enkephalin and substance P in isolated tissue from the dorsal zone of the rat spinal cord. Has an analgesic effect when administered to rats by intravenous injection. |
| Length | 146 |
| Molecular Weight | 15 |
| Name | SMR1 protein |
| Sequence | RGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK |
| Sequence map | 25-26 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|