| Primary information |
|---|
| ID | 13649 |
| Uniprot ID | P09531 |
| Description | Transforming growth factor beta-1 proprotein [Cleaved into- Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1)] |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | [Latency-associated peptide]- Secreted; extracellular space; extracellular matrix |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | Transforming growth factor beta-1 proprotein- The precursor proprotein is cleaved in the Golgi apparatus to form Transforming growth factor beta-1 (TGF-beta-1) and Latency-associated peptide (LAP) cha |
| Function | Transforming growth factor beta-1 proprotein- Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains; which constitute the regulatory and active subunit of TGF-beta-1; respectively. |
| Length | 391 |
| Molecular Weight | 44 |
| Name | Latency-associated peptide |
| Sequence | STCQRLDLEAAKKKRIEAVRGQILSKLRLTAPPPASETPPRPLPDDVRALYNSTQELLKQRARLRPPPDGPDEYWAKELRRIPMETTWDGPMEHWQPQSHSIFFVFNVSRVRAEVGGRALLHRAELRMLRQKAAADSAGTEQRLELYQGYGNASWRYLHGRSVRATADDEWLSFDVTDAVHQWLSGSELLGVFKLSVHCPCEMGPGHADEMRISIEGFEQQRGDMQSIAKKHRRVPYVLAMALPAERANELHSARRRR |
| Sequence map | 23-37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | [Latency-associated peptide]: The 'straitjacket' a |
| Pharmaceutical Use | NA
|