Primary information |
---|
ID | 13648 |
Uniprot ID | Q06141 |
Description | Regenerating islet-derived protein 3-alpha (REG-3-alpha) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted Note=Found in the apical region of pancreatic acinar cells. |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute |
Post Translational Modification | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity. |
Function | Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. |
Length | 175 |
Molecular Weight | 19 |
Name | Regenerating islet-derived protein 3-alpha 16.5 kDa form |
Sequence | EPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
Sequence map | 29-55 |
PDB ID | 1UV0; 2GO0; 4MTH; |
Drugpedia | NA |
Receptor | NA |
Domain | The EPN motif is essential for recognition of the |
Pharmaceutical Use | NA
|