| Primary information |
|---|
| ID | 13647 |
| Uniprot ID | O09049 |
| Description | Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 3) (Regenerating islet-derived protein III-gamma) (Reg III-gamma) [Cleaved into- Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted Cytoplasm |
| Developmental Stage | In mid-small intestine; very low levels at birth. Expression levels rise dramatically during the weaning period (P17-P22) and remain high into adulthood in conventionally raised but not germfree anima |
| Similarity | NA |
| Tissue Specificity | Predominantly expressed in the small intestine; including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin |
| Post Translational Modification | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity. |
| Function | Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity; whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury. |
| Length | 174 |
| Molecular Weight | 19 |
| Name | Regenerating islet-derived protein 3-gamma 16.5 kDa form |
| Sequence | VAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA |
| Sequence map | 29-54 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The EPN motif is essential for recognition of the |
| Pharmaceutical Use | NA
|