| Primary information |
|---|
| ID | 13646 |
| Uniprot ID | I7C2V3 |
| Description | Spexin prohormone 1 (Spexin hormone) [Cleaved into- Spexin-1] |
| Organism | Carassius auratus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Cyprinidae; Cyprininae; Carassius; Carassius auratus (Goldfish) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the spexin family. |
| Tissue Specificity | Expressed in the anterior hypothalamus; ventromedial thalamic nucleus and medial longitudinal fasciculus of the brain (at protein level). Widely expressed. Expressed predominantly in the spleen; kidne |
| Post Translational Modification | NA |
| Function | Plays a role in the regulation of food intake and body weight and in reproduction. May also play a role as a central modulator of cardiovascular and renal function and nociception. |
| Length | 102 |
| Molecular Weight | 11 |
| Name | Spexin prohormone 1 |
| Sequence | PMGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESQSQNTENLSISKAAAFLLNVLQQARDEGEPY |
| Sequence map | 28-42 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|