| Primary information |
|---|
| ID | 13643 |
| Uniprot ID | P0DN43 |
| Description | Terepressin/terephysin (Conopressin/Conophysin-like) [Cleaved into- Terepressin (Conopressin-like); Terephysin (Conophysin-like)] |
| Organism | Terebra subulata |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Terebridae (auger shells); Terebra; Terebra subulata (Chocolate spotted auger) (Buccinum subulatum) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | Expressed by the venom duct. |
| Post Translational Modification | [Terephysin]- contains 7 disulfide bonds. |
| Function | NA |
| Length | 134 |
| Molecular Weight | 14 |
| Name | Terephysin |
| Sequence | PTRQCMSCGPEGVGQCVGPSICCGLAIGCLMGTSEAEVCQKENESSAPCAVSGRHCGMDNTGNCVADGICCVEDACSFNSLCR |
| Sequence map | 53-14 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The cysteine framework of the terepressin is C-C. |
| Pharmaceutical Use | NA
|