| Primary information |
|---|
| ID | 13642 |
| Uniprot ID | P04279 |
| Description | Semenogelin-1 (Cancer/testis antigen 103) (Semenogelin I) (SGI) [Cleaved into- Alpha-inhibin-92; Alpha-inhibin-31; Seminal basic protein] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the semenogelin family. |
| Tissue Specificity | Seminal vesicle. |
| Post Translational Modification | Transglutaminase substrate.; Rapidly cleaved after ejaculation by KLK3/PSA; resulting in liquefaction of the semen coagulum and the progressive release of motile spermatozoa. |
| Function | Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA. |
| Length | 462 |
| Molecular Weight | 52 |
| Name | Semenogelin-1 |
| Sequence | KGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT |
| Sequence map | 31-42 |
| PDB ID | NA |
| Drugpedia | DB01593;DB14487;DB14533;DB14548; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|