| Primary information |
|---|
| ID | 13630 |
| Uniprot ID | Q9W4Q9 |
| Description | Probable insulin-like peptide 7 (dILP7) (Insulin-related peptide 7) [Cleaved into- Probable insulin-like peptide 7 A chain; Probable insulin-like peptide 7 B chain] |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the embryo and larva. |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Broadly expressed at a low level throughout the embryo; except the yolk. Expressed at a moderate level in the embryonic midgut. Larval expression is restricted to ten cells of the ventral nerve cord - |
| Post Translational Modification | NA |
| Function | NA |
| Length | 159 |
| Molecular Weight | 18 |
| Name | Probable insulin-like peptide 7 |
| Sequence | QHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY |
| Sequence map | 34-39 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|