Primary information |
---|
ID | 13630 |
Uniprot ID | Q9W4Q9 |
Description | Probable insulin-like peptide 7 (dILP7) (Insulin-related peptide 7) [Cleaved into- Probable insulin-like peptide 7 A chain; Probable insulin-like peptide 7 B chain] |
Organism | Drosophila melanogaster |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
Subcellular Location | Secreted |
Developmental Stage | Expressed in the embryo and larva. |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Broadly expressed at a low level throughout the embryo; except the yolk. Expressed at a moderate level in the embryonic midgut. Larval expression is restricted to ten cells of the ventral nerve cord - |
Post Translational Modification | NA |
Function | NA |
Length | 159 |
Molecular Weight | 18 |
Name | Probable insulin-like peptide 7 |
Sequence | QHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY |
Sequence map | 34-39 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|