| Primary information |
|---|
| ID | 13622 |
| Uniprot ID | Q9VT53 |
| Description | Probable insulin-like peptide 4 (dILP4) (Insulin-related peptide 4) [Cleaved into- Probable insulin-like peptide 4 A chain; Probable insulin-like peptide 4 B chain] |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the embryo (beginning at the blastoderm stage); and in the larva. |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed at a high level in the embryonic mesoderm; with expression continuing after gastrulation and reducing from stage 12 onwards. Highly expressed in the embryonic anterior midgut rudiment and la |
| Post Translational Modification | NA |
| Function | NA |
| Length | 134 |
| Molecular Weight | 15 |
| Name | Probable insulin-like peptide 4 |
| Sequence | RKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYCA |
| Sequence map | 29-14 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|