| Primary information |
|---|
| ID | 13618 |
| Uniprot ID | G7NYP9 |
| Description | Osteocrin [Cleaved into- Processed Osteocrin] |
| Organism | Macaca fascicularis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the Osteocrin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience. Induced in the brain following membrane depolarization and inhibits dendritic branching in neurons of the developing cortex. Probably acts by binding to natriuretic peptide receptor NPR3/NPR-C; thereby preventing binding between NPR3/NPR-C and natriuretic peptides; leading to increase cGMP production. |
| Length | 133 |
| Molecular Weight | 14 |
| Name | Osteocrin |
| Sequence | DVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG |
| Sequence map | 30-13 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|