| Primary information |
|---|
| ID | 13617 |
| Uniprot ID | P61366 |
| Description | Osteocrin (Musclin) [Cleaved into- Processed Osteocrin] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Expression in the developing cerebral cortex increases during the course of fetal development and peaks around the late-mid fetal stage; concurrent with the onset of synaptogenesis in the cortical pla |
| Similarity | Belongs to the Osteocrin family. |
| Tissue Specificity | Enriched in neocortical regions of the developing cerebral cortex (PubMed-27830782). Not expressed in other compartments of the neocortical wall or in brain regions such as the hippocampus; striatum; |
| Post Translational Modification | NA |
| Function | Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience |
| Length | 133 |
| Molecular Weight | 14 |
| Name | Osteocrin |
| Sequence | DVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG |
| Sequence map | 30-13 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|