| Primary information |
|---|
| ID | 13609 |
| Uniprot ID | P61365 |
| Description | Osteocrin (Musclin) [Cleaved into- Processed Osteocrin] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | Expression was highest in embryos and neonates; peaking at 4 days of age in both calvaria and long bones and decreasing steadily with age to very low levels in 8-month-old long bones. The age-related |
| Similarity | Belongs to the Osteocrin family. |
| Tissue Specificity | Highly expressed in skeletal muscle (PubMed-15044443). Also expressed in leg tendons/ligaments and osteoblasts (PubMed-17951249). In long bones and teeth; present in knee joint and periodontal ligamen |
| Post Translational Modification | NA |
| Function | Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C; thereby preventing binding between NPR3/NPR-C and natriuretic peptides; leading to increase cGMP production. Required to enhance physical endurance- induced following physical exercise in muscle and promotes cGMP production; probably by interacting with NPR3/NPR-C. May act as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle. |
| Length | 132 |
| Molecular Weight | 14 |
| Name | Osteocrin |
| Sequence | SVDLASEASEFGAESLQSPPTTREEKSATELAAKLLLLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSRG |
| Sequence map | 28-12 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|