| Primary information |
|---|
| ID | 13608 |
| Uniprot ID | P61364 |
| Description | Osteocrin (Musclin) [Cleaved into- Processed Osteocrin] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed during matrix production and maturation. Also expressed during myocyte differentiation. |
| Similarity | Belongs to the Osteocrin family. |
| Tissue Specificity | Expressed in skeletal muscle and to a much lesser extent in bone; brown adipose tissue; spleen and testis (PubMed-14523025; PubMed-15044443; PubMed-26668395). Not expressed in neurons (PubMed-27830782 |
| Post Translational Modification | NA |
| Function | Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C; thereby preventing binding between NPR3/NPR-C and natriuretic peptides; leading to increase cGMP production |
| Length | 130 |
| Molecular Weight | 14 |
| Name | Osteocrin |
| Sequence | SVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG |
| Sequence map | 28-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|