Primary information |
---|
ID | 13599 |
Uniprot ID | P02761 |
Description | Major urinary protein (MUP) (Allergen Rat n I) (Alpha(2)-euglobulin) (Alpha-2u-globulin) (alpha-2u globulin PGCL1) (allergen Rat n 1) [Cleaved into- 15.5 kDa fatty acid-binding protein (15.5 kDa FABP)] |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | [15.5 kDa fatty acid-binding protein]- Cytoplasm; cytosol. Note=It is probably taken up from the uri |
Developmental Stage | NA |
Similarity | Belongs to the calycin superfamily. Lipocalin family. |
Tissue Specificity | Abundant in the urine of adult male rats but absent from that of females. |
Post Translational Modification | NA |
Function | Major urinary proteins (Mups) bind and release pheromones. They may also protect pheromones from oxidation. In this context; they play a role in the regulation of social behaviors; such as aggression; mating; pup-suckling; territory establishment and dominance. Acts as a kairomone; detected by the prey vomeronasal organ and inducing fear reactions in mice. |
Length | 181 |
Molecular Weight | 20 |
Name | Major urinary protein |
Sequence | EASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG |
Sequence map | 23-01 |
PDB ID | 2A2G; 2A2U; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|