| Primary information |
|---|
| ID | 13595 |
| Uniprot ID | Q14641 |
| Description | Early placenta insulin-like peptide (EPIL) (Insulin-like peptide 4) (Placentin) [Cleaved into- Early placenta insulin-like peptide B chain; Early placenta insulin-like peptide A chain] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Highly expressed in the early placenta. Expression of epil peptides in the villous cytotrophoblast is different from that displayed by the syncytiotrophoblast. In fetal tissues it was identified in th |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed in placenta; uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. |
| Post Translational Modification | NA |
| Function | May play an important role in trophoblast development and in the regulation of bone formation. |
| Length | 139 |
| Molecular Weight | 15 |
| Name | Early placenta insulin-like peptide |
| Sequence | ELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT |
| Sequence map | 28-19 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|