| Primary information |
|---|
| ID | 13594 |
| Uniprot ID | Q9VT51 |
| Description | Probable insulin-like peptide 2 (dILP2) (Insulin-related peptide 2) [Cleaved into- Probable insulin-like peptide 2 A chain; Probable insulin-like peptide 2 B chain] |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the embryo and larva. |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Broadly expressed at a low level in the embryonic mesoderm; beginning at stage 12. Expressed at a high level in the embryonic anterior midgut; with expression diminishing at late stage 16. Expressed a |
| Post Translational Modification | NA |
| Function | Plays a role in regulating body size by increasing cell size and cell number of individual organs. Probably mediates its growth effects by acting as a ligand for the insulin receptor and transducing a signal via the Chico/PI3K/Akt(PKB) pathway. |
| Length | 137 |
| Molecular Weight | 15 |
| Name | Probable insulin-like peptide 2 |
| Sequence | LCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN |
| Sequence map | 29-17 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|